Follow By Email

Thursday, June 1, 2023

[New post] Hard reality: 7 Strange landscapes

Site logo image hoakley posted: "Reflections in landscapes are sufficiently difficult that even the most proficient of painters has made the occasional optical error in their depiction. Unlike reflections in mirrors, or shadows, few have deliberately or persistently defied optical laws. " The Eclectic Light Company

Hard reality: 7 Strange landscapes

hoakley

Jun 1

Reflections in landscapes are sufficiently difficult that even the most proficient of painters has made the occasional optical error in their depiction. Unlike reflections in mirrors, or shadows, few have deliberately or persistently defied optical laws. In this article I examine two: one of Ferdinand Hodler's Parallelist landscapes, which were clearly intentional, and the many aberrant paintings of reflections by Paul Cézanne, which remain an enigma.

hodlerrhythmiclandscapelakegeneva
Ferdinand Hodler (1853–1918), Rhythmic Landscape on Lake Geneva (1908), oil on canvas, 67 x 91 cm, Private collection. Wikimedia Commons.

Hodler has repeatedly demonstrated a thorough understanding of the optical principles of reflections on water, and his skill at depicting them faithfully. However, in 1908 when he was in pursuit of Parallelist ideals, he painted this Rhythmic Landscape on Lake Geneva. This was a second version of a view he had previously painted three years earlier, when he wrote "This is perhaps the landscape in which I applied my compositional principles most felicitously."

Most of his symmetry and rhythm is obvious; what may not be so apparent are the idiosyncratic reflections seen on the lake's surface. The gaps in the train of cumulus clouds here become optically impossible dark blue pillars, responsible for much of the rhythm in the lower half of the painting.

In contrast, Paul Cézanne painted reflections on water throughout his long career, almost every one of which ignores optical principles. I have examined images of 27 oil paintings and four watercolours of his, covering the period from 1860 to 1904: every one of those 31 paintings analysed contained visible, usually obvious, disparities in their reflections. I matched a total of 179 features in those paintings across real and virtual images, and found 22% that have lateral displacements in reflections of 10 mm or more, and 8% by 20 mm or more. Of those lateral displacements, 85% were shifts to the right of the reflected from the real image. Only 10% of the 31 paintings showed no displacements in reflected features. Here I show just three of the more significant examples.

cézannebordsdeloise
Paul Cézanne (1839–1906), Paysage des Bords de l'Oise (Landscape on the Banks of the Oise) (1873-4) (R224), oil on canvas, 73.5 x 93 cm, Palais Princier, Monaco. WikiArt.

Landscape on the Banks of the Oise is an Impressionist view from Cézanne's first campaign along the River Oise, when he painted in company with Pissarro, and shows the northern bank near the hamlet of Valhermeil.

cézannebordsdeloisec
Paul Cézanne (1839–1906), Paysage des Bords de l'Oise (Landscape on the Banks of the Oise) (1873-4) (R224), oil on canvas, 73.5 x 93 cm, Palais Princier, Monaco. WikiArt. Composite image to show discrepancies in reflections.

Although reflections only appear in a narrow band at the foot of the picture, that depicting the house with a red roof is particularly prominent, and visibly out of alignment with its original. Measured lateral displacement in the reflected image of that house ranges from 27-39 mm, representing 3-4% of the total width of the painting. There are 4 other displacements ranging from 10 to 17 mm. All the displacements seen are of the reflection to the the right of the position expected according to optical principles.

Although the view shown doesn't make it clear, at this point even in Cézanne's day the River Oise wasn't just a few metres wide, but was and remains a broad navigable waterway. It's almost certain that Cézanne painted this from the southern bank of the Oise, at least 70 m away from the depicted reflections. Measurements made from recent satellite imagery and compared with maps of the time show that the house with the red roof was approximately 70 m and no less than 50 m from the water's edge. Assuming that the bank on which Cézanne placed his easel was about 3 m above water level, and his eye was about 1.5 m above that, basic trigonometry shows that the red roof of the house should also have been about 4.5 m above water level, which wouldn't be compatible with the view as depicted.

Therefore the reflections as shown cannot have been painted faithfully from nature, but must have been displaced from elsewhere or constructed from Cézanne's imagination, possibly at a later time when no longer in front of the motif.

Closer examination of the reflected image of the house with the red roof suggests another issue which merits further study of the painting. Cézanne appears to have made pentimenti to its left edge, at least, and possibly at its right edge too. It appears that an earlier attempt to paint the red roof may have shown it extending more to the left, where it would have been displaced less than now appears.

cézannebordsdeloised
Paul Cézanne (1839–1906), Paysage des Bords de l'Oise (Landscape on the Banks of the Oise) (1873-4) (R224), oil on canvas, 73.5 x 93 cm, Palais Princier, Monaco. WikiArt. Composite image of detail, adjusted to align the original and reflected images.

These can be seen more clearly in the composite image above, in which I have moved the reflected image to the left so that it does align 'correctly' with the real image.

This also brings out other problems in the reflection, including the higher chroma in the red, the missing white gable ends and blue blinds on the window, and the excessive height of the chimney at the right end. To the right of the reflection there also appears to be some blue, which could have been an earlier depiction of the house to the right, which is set back even further than that with the red roof. Few if any cast shadows can be seen, the only possible ones being shown at the eaves of some roofs. In the case of the house with the red roof, these are also shown in the reflected image.

Problems in the reflections in this painting have recently been recognised by Denis Coutagne (2011), who wrote: "Curieusement, le paysage est traité de manière assourdie dans le plan d'eau. D'ailleurs, le reflet et la réalité ne se répondent pas vraiment." (Curiously, the landscape is treated in a muted way in the water. Moreover, the reflection and reality do not correspond faithfully.) (p. 74.)

cézannebassinjdbouffan
Paul Cézanne (1839–1906), Le Bassin du Jas de Bouffan en Hiver (The Pond of the Jas de Bouffan in Winter) (1878) (R350), oil on canvas, 52.5 x 56 cm, Private collection. WikiArt.

In this painting of The Pond of the Jas de Bouffan in Winter, a view Cézanne must have seen almost every day that he went out from his family home, there are multiple discrepancies between the original and reflected areas, and evidence of pentimenti in the right side of the reflection.

Looking over the pool, the painting's midline is marked by a tree, behind which are various buildings. At the left, closest to the viewer, branches of an evergreen tree are seen in front of the nearest large building. From that a series of smaller sheds track across the middle of the painting, culminating in a wall. Behind those are a farmhouse, and a sloping field with light brown and green stripes.

Cast shadows are shown sparingly around the central sheds, but not elsewhere, although the motif appears to be lit from the right. However the reflections shown bear little resemblance to the rest of the painting, with disparities obvious in every object seen in the reflections, and apparently large areas of pentimenti on the right side of the reflections. Lateral displacements in the reflections are, though, relatively small. Ten features were measured, eight of which showed displacements of up to 10 mm. These are seen in the composite view.

cézannebassinjdbouffanc
Paul Cézanne (1839–1906), Le Bassin du Jas de Bouffan en Hiver (The Pond of the Jas de Bouffan in Winter) (1878) (R350), oil on canvas, 52.5 x 56 cm, Private collection. WikiArt. Composite image to show discrepancies in reflections.

Reading the reflections from the left, those of the evergreen branches are shown almost vertically below their real images, although it is unlikely that they would have been visible at all in the confines of this view. Behind that foliage, the reflection shows a clear vertical line corresponding to the end or corner of a building, which is off to the left of the canvas in the original image.

The highest section of building then has dark green marks on it either representing windows that don't appear in the original, or arising from alteration of previous positioning of the evergreen branch. The adjoining shed immediately to its right is omitted from the reflection, as are all remaining structures running from it across to the right of the painting, although some, perhaps all, would have been expected to appear in the reflected image.

Instead, Cézanne puts objects from much further back into the reflection. First are dark vertical strokes resembling the palings of a fence, which doesn't appear at all in the original image above. These can only represent a bare tree which is shown behind the shed. He then shows a simplified reflection of the distant farmhouse. This lacks its single-storey lean-to extension, has two windows and a door differing in the reflection in both placement and form, a red roof with a different outline and colour in reflection, and the prominent chimney at the right of the house is also omitted.

The reflection of the prominent tree forming a central vertical midline to the painting doesn't follow the form of the real image, with a marked 'S' bend visible in the original, shown only on the right side of its reflection, too close to its base.

cézannebassinjdbouffand
Paul Cézanne (1839–1906), Le Bassin du Jas de Bouffan en Hiver (The Pond of the Jas de Bouffan in Winter) (detail) (1878) (R350), oil on canvas, 52.5 x 56 cm, Private collection. WikiArt.

To the right of this, the reflection shows the right end of the distant farmhouse, then a large area in which there appear to have been extensive pentimenti, leaving no clear forms or objects depicted. Faint dark marks could have been intended to represent three bare trees shown on the sloping field above, but they appear too far back and placed differently. Neither do they match any structures shown in the closer buildings or wall. The only objects which they appear to correspond with are the door and windows of the farmhouse, on the opposite side of the painting.

More recent photographs show a similar view, although it is claimed that Cézanne painted from a slightly elevated point on the top of a building. That couldn't account, though, for the completely different reflections seen in the photographs. Unfortunately the distant farm has since been demolished, so its precise position is no longer visible on modern satellite imagery. However estimates from satellite images confirm that the distant farmhouse would not have been visible in the reflections.

Assuming that Cézanne painted this when he was 4.5 metres above the water level in the pool, and about 10 metres from the reflections at the end of the pool, if the farmhouse was 100 metres distant from the end of the pool, it would have had to have been 45 metres above the water level of the pool to appear in the reflections.

The further back the farmhouse was from that position, the greater its elevation would have had to have been. Cézanne therefore seems to have made a decision to omit the more likely reflections of the nearer outhouses and wall, and instead to have added the optically impossible reflection of the distant farmhouse.

Without knowing more about the making of this painting it's impossible to know what these reflections represent. One possible explanation is that Cézanne tried a technique sometimes recommended for painting reflections, rotating the canvas by 180˚, and inadvertently as a result painted the reflection of the farmhouse on the wrong side of the pool. On restoring the orientation of the canvas, he then tried to correct the reflection, but didn't complete its detail. However this doesn't explain why he painted the distant farmhouse in reflection in the first place.

Denis Coutagne's (2006) account of this reads: "In The Basin of the Jas de Bouffan in Winter the liquid surface becomes a revealing screen. The reflection is something of a paradox, for instead of offering an inverted replica of the view it recomposes, it instead becomes a metaphor for the artist's own painting. Cézanne had perhaps not broken with his Parisian friends, but he was travelling a quite distant path."

Arroye (2011) accepted the disparities, putting a clearer case for them being compositional in nature, writing: "Dans Le Bassin du Jas de Bouffan en hiver (...), les libertés prises avec la réalité sont encore plus grandes. Le tableau est partagé en deux par un arbre prolongé par son reflet dans le bassin qui occupe encore toute la largeur du bas de tableau mais sur une plus grande hauteur: Cézanne a simplifié la ramure de l'arbre et, sur sa droite, fair paraître dans le bassin le reflet d'un bâtiment trop éloigné pour qu'on puisse l'y voir. C'est qu'il voulait fortement opposer les deux parties de son tableau séparées par l'arbre: sur la gauche, de nombreux bâtiments occupent l'espace qui est structuré par l'articulation de leurs formes géométriques simplifi\'{e}es; sur la droite, le terrain n'est pas construit, des bandes de terre herbue et suscitent une organisation rythmique de l'espace. Cézanne ainsi confronte deux modes d'organisation du paysage, l'un analytique et protocubiste, a-t-on envie de dire, l'autre schématique et abstractisant. Dans le bassin leur opposition s'accentue; le miroir des eaux est un miroir grossissant des enjeux de cette réflexion poiétique." (p. 160.)

("In The Pool at the Jas de Bouffan in Winter (...) the liberties taken with reality are even greater. The picture is divided into two by a tree and its reflection in the pool, which again occupies the entire width of the bottom of the painting, but is slightly higher: Cézanne has simplified the tree's branches, and to its right in the pond he shows the reflection of a building that is too far away for it to be seen in this way. He did this because he had a strong desire to contrast the two sections of his painting separated by the tree: The left space is filled with numerous buildings and is structured by the articulation of their simplified geometric forms; on the right, the land is not built up, and alternative bands of grassy and cultivated ground create a rhythmic organization of the space. In this way Cézanne compares two methods of organizing landscape--one analytical and, we are tempted to say, early Cubist; the other schematic and abstract in form. The contradictions between them are accentuated in the pool; the mirror of the water increases the stakes of this poietic reflection.")

I conclude with one of Cézanne's most famous paintings, that of Lake Annecy completed in 1896.

cézannelacdannecy
Paul Cézanne (1839–1906), Le Lac d'Annecy (Lake Annecy) (1896) (R805), oil on canvas, 65 x 81 cm, The Courtauld Gallery, London (Samuel Courtauld Trust) (P.1932.SC.60). Wikimedia Commons.

This shows a view across Lake Annecy from Talloires, featuring the distinctive Château de Duingt and foothills rising behind it. The water surface is shown to cover almost the entire lower half of the painting, within which the reflections of the castle are central and dominant features.

Comparison with views of the actual motif reveals that Cézanne has brought the far shore considerably closer to the viewer than it really is, by enlarging all the objects on that shore. House (2008) stated that the château is about one mile away from Cézanne's viewpoint, but measurement on modern satellite images shows the distance to be 0.76 km or just under half a mile.

However, neither that nor optical principles suggest that the reflections could possibly appear the way that Cézanne has painted them, although the problems here aren't in lateral alignment.

cézannelacdannecyc
Paul Cézanne (1839–1906), Le Lac d'Annecy (Lake Annecy) (1896) (R805), oil on canvas, 65 x 81 cm, The Courtauld Gallery, London (Samuel Courtauld Trust) (P.1932.SC.60). Wikimedia Commons. Composite image to show discrepancies in reflections.

As revealed in the composite image above, immediately to the right of the tree trunk shown marking most of the left in repoussoir, the water surface is depicted as being pale blue, with two light vertical marks which should represent reflections, although the area being reflected is shown much darker in the original image and lacks any object corresponding to the vertical marks.

Moving right across the reflection, there should then be a green area to match the original greenery shown on the left of the château, but the water surface there remains a mid blue. Although the original image of the castle closely resembles photographs, the reflection shown appears to be that of a quite different object, consisting of two tall, slightly slanting, pale cylinders, neither of which is aligned with the edge or tower shown.

The original image of the castle is shown to be dark green-blue towards its right, which isn't matched in the reflection. In the middle of the lower part of the lake various light patches of paint don't appear to match any corresponding light areas in the original image above, where light patches are placed diagonally, rising to the left of the painting.

The right edge of the promontory on which the castle is situated also differs between the original and reflection, and two vertical green marks in the reflection straddle a higher dark green mass in the original. The far right section of the shore, set further back, has reflections differing from the original image too: although the red-roofed building is depicted in reflection, the reflection shown of the shoreline appears much darker than the bright original.

Recognising the remarkably distorted reflections, the late Professor John House (2008) commented on them, writing "The reflections in the water are slightly distorted - like the table legs in The Card Players, they are not exactly vertical; and the water surface is implausibly still; Cézanne took no interest in the specific play of reflections that played so central a part in the art of Claude Monet, whose work he nevertheless greatly admired."

In contrast, Machotka (2008) wrote that they were driven by compositional considerations: "Early in the morning, at the time that Cézanne painted, the lake could be perfectly still and mirror the buildings and hills; this explains why Cézanne could see the château's reflection without inventing it, and why greens could be seen in the water on either side of a pure blue center: this is a reflection of the two hills and the open sky between them. This is not an everyday occurrence, but Cézanne had to see it like this at least once, to know that a composition based on the view would be connected from top to bottom naturally, rather than divided by the distant shore. But if the suggestion of unity was in the site, its realization was Cézanne's." (pp. 215-216.)

We'll never know whether Cézanne was unable to understand or express reflections according to optical principles, or whether he intentionally painted what he preferred.

References
Arrouye J (2011) "L'eau, miroir de la peinture", pp 154-161 in D Coutagne Cézanne et Paris, Rmn-Grand Palais, Paris. Translated as "Water the mirror of painting", pp 154-161 in D Coutagne Cézanne and Paris, Rmn-Grand Palais, Paris.
Coutagne D (2006) "The Jas de Bouffan", pp 76-121 in P Conisbee and D Coutagne Cézanne in Provence, Yale University Press, New Haven, CT.
Coutagne D (2011) P. Cézanne à Paris et en Île-de-France, Éditions Crès.
House J (2008) "Le Lac d'Annecy", pp 102-105 in S Buck et al. The Courtauld Cézannes, Paul Holberton Publishing, London
Machotka P (2008) Cézanne, the Eye and the Mind, Éditions Crès, Marseille.

Comment
Like
Tip icon image You can also reply to this email to leave a comment.

Unsubscribe to no longer receive posts from The Eclectic Light Company.
Change your email settings at manage subscriptions.

Trouble clicking? Copy and paste this URL into your browser:
http://eclecticlight.co/2023/06/01/hard-reality-7-strange-landscapes/

WordPress.com and Jetpack Logos

Get the Jetpack app to use Reader anywhere, anytime

Follow your favorite sites, save posts to read later, and get real-time notifications for likes and comments.

Download Jetpack on Google Play Download Jetpack from the App Store
WordPress.com on Twitter WordPress.com on Facebook WordPress.com on Instagram WordPress.com on YouTube
WordPress.com Logo and Wordmark title=

Learn how to build your website with our video tutorials on YouTube.


Automattic, Inc. - 60 29th St. #343, San Francisco, CA 94110  

at June 01, 2023
Email ThisBlogThis!Share to XShare to FacebookShare to Pinterest

No comments:

Post a Comment

Newer Post Older Post Home
Subscribe to: Post Comments (Atom)

[New post] Godzilla Library Edition by James Stokoe, John Layman, Chris Mowry, Alberto Ponticelli, Dean Haspiel

...

  • Your Ambitious Menu: 5 recipes to cook this week
    New on Ambitious Kitchen ...
  • [New post] Everyone Wants to Be a Cat
    Donna...
  • [New post] Godzilla Library Edition by James Stokoe, John Layman, Chris Mowry, Alberto Ponticelli, Dean Haspiel
    ...

Search This Blog

  • Home

About Me

PH News Net
View my complete profile

Report Abuse

Labels

  • 【ANDROID STUDIO】Data Binding
  • 【ANDROID STUDIO】Data Binding Show or Hide Progressbar
  • 【ANDROID STUDIO】Data Binding with object
  • 【ANDROID STUDIO】Live Data
  • 【ANDROID STUDIO】Live Data with Data Binding
  • 【ANDROID STUDIO】View Model
  • 【ANDROID STUDIO】ViewModel Data Binding
  • 【ANDROID STUDIO】ViewModel Data Binding Factory
  • 【FLUTTER ANDROID STUDIO and IOS】Common Weight and Mass Conversions
  • 【FLUTTER ANDROID STUDIO and IOS】custom lite rolling switch
  • 【FLUTTER ANDROID STUDIO and IOS】Managing State
  • 【FLUTTER ANDROID STUDIO and IOS】Simple Stopwatch
  • 【FLUTTER ANDROID STUDIO and IOS】Specify Height and Width in Percent with respect to the screen
  • 【FLUTTER ANDROID STUDIO and IOS】tab key or shift focus to next text field
  • 【FLUTTER ANDROID STUDIO and IOS】Weight Convert
  • 【GAMEMAKER】Display
  • 【GAMEMAKER】Draw Name
  • 【GAMEMAKER】enemy fire continously
  • 【GAMEMAKER】Energy
  • 【GAMEMAKER】Explosion
  • 【GAMEMAKER】Health Bar
  • 【GAMEMAKER】Hearts
  • 【GAMEMAKER】Highscore
  • 【GAMEMAKER】Horizontal Shooter
  • 【GAMEMAKER】Inventory
  • 【GAMEMAKER】keep the player facing the mouse pointer
  • 【GAMEMAKER】one way to do a fog of war
  • 【JAVASCRIPT】implements draggable progress bar
  • 【JAVASCRIPT】Math Quiz GAME export CSV
  • 【LARAVEL】PHPWord pass dynamic values when export to ms docx and download using PHPWord
  • 【PYTHON OPENCV】Image classification in Keras using several models for image classification with weights trained on ImageNet
  • 【PYTHON PYTORCH】metric classification accuracy
  • 【PYTHON PYTORCH】metric classification report
  • 【PYTHON】algorithm compare all classification models
  • 【PYTHON】algorithm evaluation k fold cross validation
  • 【PYTHON】leave one out cross validation
  • 【PYTHON】metric confusion
  • 【PYTHON】metric regression mae
  • 【VISUAL Csharp】Enumerate network resources
  • 【VISUAL Csharp】File Properties
  • 【Visual Studio VB NET】Clear Saved Passwords
  • 【Visual Studio VB NET】Swap mouse button
  • 【Visual Studio VB NET】System Properties Remote
  • 【Visual Studio Visual Csharp】Get computer name
  • 【Visual Studio Visual Csharp】Get Disk Free Space
  • 【Visual Studio Visual Csharp】Get processor type
  • 【Visual Studio Visual Csharp】IP Address
  • 【VISUAL VB NET】Delete Form Data
  • 【VISUAL VB NET】Delete History
  • 【VISUAL VB NET】Hibernate
  • 【VISUAL VB NET】Keyboard Properties
  • 【VISUAL VB NET】Sound
  • 【VISUAL VB NET】Tray Icon
  • 【VISUAL VB NET】Web Browser
  • 【Vuejs】 table implements adding and deleting
  • 【VUEJS】seamless carousel effect Marquee using transition

Blog Archive

  • October 2023 (25)
  • September 2023 (1209)
  • August 2023 (1224)
  • July 2023 (1259)
  • June 2023 (1245)
  • May 2023 (1194)
  • April 2023 (1137)
  • March 2023 (1163)
  • February 2023 (1107)
  • January 2023 (1313)
  • December 2022 (1358)
  • November 2022 (1353)
  • October 2022 (1300)
  • September 2022 (1208)
  • August 2022 (1279)
  • July 2022 (1228)
  • June 2022 (1164)
  • May 2022 (1176)
  • April 2022 (1184)
  • March 2022 (1337)
  • February 2022 (1232)
  • January 2022 (1321)
  • December 2021 (1932)
  • November 2021 (3065)
  • October 2021 (3186)
  • September 2021 (3078)
  • August 2021 (3175)
  • July 2021 (3198)
  • June 2021 (3136)
  • May 2021 (1856)
Powered by Blogger.